PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G30210.1
Common NameATMYB121, MYB121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 276aa    MW: 31369.6 Da    PI: 6.8857
Description myb domain protein 121
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G30210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.71.8e-202976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll+++v+ +G g+W+t+a++ g++R++k+c++rw +yl
      AT3G30210.1 29 KGPWTLEEDKLLAEYVTSHGEGRWSTVAKCAGLNRSGKSCRLRWVNYL 76
                     79********************************************97 PP

2Myb_DNA-binding507.1e-1682126147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ ++++++ ++G++ W+tIar+++ gRt++++k++w+++
      AT3G30210.1  82 RGQITPQEEGIILELHSLWGNK-WSTIARYLP-GRTDNEIKNYWRTH 126
                      7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9922476IPR017930Myb domain
SuperFamilySSF466897.7E-3226123IPR009057Homeodomain-like
SMARTSM007174.0E-162878IPR001005SANT/Myb domain
PfamPF002493.3E-182976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-233083IPR009057Homeodomain-like
CDDcd001671.70E-123176No hitNo description
PROSITE profilePS5129423.83277131IPR017930Myb domain
SMARTSM007171.8E-1381129IPR001005SANT/Myb domain
PfamPF002491.0E-1382126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2384130IPR009057Homeodomain-like
CDDcd001673.95E-1086126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009737Biological Processresponse to abscisic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MLDWGVQGHH QKHDHDIYQQ QHQQQGCRKG PWTLEEDKLL AEYVTSHGEG RWSTVAKCAG  60
LNRSGKSCRL RWVNYLRPGL KRGQITPQEE GIILELHSLW GNKWSTIARY LPGRTDNEIK  120
NYWRTHYKKN QKSSSKQDKV KKSLSRKQQQ VDLKPQPQAQ SENHQSQLVS QDHMNIDNDH  180
NIASSLYYPT SVFDDKLYMP QSVATTSSDH SMIDEGHLWG SLWNLDEDDP HSFGGGSGQG  240
TAADIDEKFP DSGIEAPSCG SGDYSYTGVY MGGYIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25291297106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257307_at1e-173
Expression AtlasAT3G30210-
AtGenExpressAT3G30210-
ATTED-IIAT3G30210-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor, member of the R2R3 factor gene family (MYB121).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G30210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G30210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719800.0AF371980.2 Arabidopsis thaliana putative transcription factor MYB121 (MYB121) mRNA, complete cds.
GenBankAY5195930.0AY519593.1 Arabidopsis thaliana MYB transcription factor (At3g30210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189640.10.0myb domain protein 121
TrEMBLQ9LRU50.0Q9LRU5_ARATH; MYB transcription factor
STRINGAT3G30210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]